PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c12_3580V3.1.p
Common NameHAP3C
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NF-YB
Protein Properties Length: 219aa    MW: 23914.6 Da    PI: 6.4186
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c12_3580V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB188.45.2e-5934130197
              NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                        vreqdrflPianvsrimkk+lP+nakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyveplkvyl+kyre
  Pp3c12_3580V3.1.p  34 VREQDRFLPIANVSRIMKKALPSNAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMSTLGFEDYVEPLKVYLHKYRE 125
                        69****************************************************************************************** PP

              NF-YB  93 legek 97 
                        legek
  Pp3c12_3580V3.1.p 126 LEGEK 130
                        ***97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.5E-5630149IPR009072Histone-fold
SuperFamilySSF471133.57E-4237147IPR009072Histone-fold
PfamPF008084.1E-2840104IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.5E-216886No hitNo description
PROSITE patternPS0068507187IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.5E-2187105No hitNo description
PRINTSPR006151.5E-21106124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MADSYGHNPG SPENDPHSDN ESGGGHYRDH DASVREQDRF LPIANVSRIM KKALPSNAKI  60
SKDAKETVQE CVSEFISFIT GEASDKCQRE KRKTINGDDL LWAMSTLGFE DYVEPLKVYL  120
HKYRELEGEK TSVTKGGDHS AGKESNQSNQ GGIGSLGMPG GMIGMNGSMH QQGIPVSMQM  180
MQQSYGHQSP LGMMFAPHQT IPQYQMSMQS GSNQSRGL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B2e-4834125192Transcription factor HapC (Eurofung)
4g91_B2e-4834125192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0198971e-143EU019897.1 Physcomitrella patens CCAAT-box binding factor HAP3-like protein (HAP3C) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001781393.13e-96predicted protein
SwissprotO233101e-70NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0I9QPN31e-163A0A0I9QPN3_PHYPA; CCAAT-box binding factor HAP3-like protein
STRINGPP1S462_7V6.11e-163(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.16e-72nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Xie Z, et al.
    Duplication and functional diversification of HAP3 genes leading to the origin of the seed-developmental regulatory gene, LEAFY COTYLEDON1 (LEC1), in nonseed plant genomes.
    Mol. Biol. Evol., 2008. 25(8): p. 1581-92
    [PMID:18453547]